
w3score.streamAll domains118182182918299182992
Worldchampionshipofpingpong.net analysis report in a nutshell:
Website caption: Home • World Championship of Ping Pong 40
Run-down: worldchampionshipofpingpong.net is hosted on server, which is located in United Kingdom.. The homepage for worldchampionshipofpingpong.net has 8 out-going links.. Currently, domain name is set to expire on 2017/Sep/27.. For Alexa Global, worldchampionshipofpingpong.net ranks at 852 168. Domain registration last updated on 2016/Sep/28.. worldchampionshipofpingpong.net registration day is 2012/Sep/27, which was 0 days ago.. In the past 3 months, worldchampionshipofpingpong.net Alexa rating increased or decreased by +103 746.
Description of this site: 0 Waiting for information
Search keyword densityNumber of times keyword appliedMost used tags

WHOIS report
Expiry date:2017/Sep/27
Registrar Whois entry:

Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: WORLDCHAMPIONSHIPOFPINGPONG.NET Registrar: GODADDY.COM, LLC Sponsoring Registrar IANA ID: 146 Whois Server: whois.godaddy.com Referral URL: http://www.godaddy.com Name Server: NS49.DOMAINCONTROL.COM Name Server: NS50.DOMAINCONTROL.COM Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Updated Date: 28-sep-2016 Creation Date: 27-sep-2012 Expiration Date: 27-sep-2017 >>> Last update of whois database: Thu, 18 May 2017 19:44:21 GMT <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars. Domain Name: WORLDCHAMPIONSHIPOFPINGPONG.NET Registrar URL: http://www.godaddy.com Registrant Name: Travis Coleman Registrant Organization: Colewood Internet Ltd Name Server: NS49.DOMAINCONTROL.COM Name Server: NS50.DOMAINCONTROL.COM DNSSEC: unsigned For complete domain details go to: http://who.godaddy.com/whoischeck.aspx?domain=WORLDCHAMPIONSHIPOFPINGPONG.NET The data contained in GoDaddy.com, LLC's WhoIs database, while believed by the company to be reliable, is provided "as is" with no guarantee or warranties regarding its accuracy. This information is provided for the sole purpose of assisting you in obtaining information about domain name registration records. Any use of this data for any other purpose is expressly forbidden without the prior written permission of GoDaddy.com, LLC. By submitting an inquiry, you agree to these terms of usage and limitations of warranty. In particular, you agree not to use this data to allow, enable, or otherwise make possible, dissemination or collection of this data, in part or in its entirety, for any purpose, such as the transmission of unsolicited advertising and and solicitations of any kind, including spam. You further agree not to use this data to enable high volume, automated or robotic electronic processes designed to collect or compile this data for any purpose, including mining this data for your own personal or commercial purposes. Please note: the registrant of the domain name is specified in the "registrant" section. In most cases, GoDaddy.com, LLC is not the registrant of domain names listed in this database.

Specified person:
Website Registered On:2012/Sep/27
Domain Mistypes:
  1. worldchampyonshipofpingpong.net
  2. worldchasmpionshipofpingpong.net
  3. worldcxhampionshipofpingpong.net
  4. worlvdchampionshipofpingpong.net
  5. worldchwampionshipofpingpong.net
  6. worldchajmpionshipofpingpong.net
  7. worldchqampionshipofpingpong.net
  8. worldchaqmpionshipofpingpong.net
  9. worldcnhampionshipofpingpong.net
  10. worldvchampionshipofpingpong.net
  11. worldxchampionshipofpingpong.net
  12. worldchgampionshipofpingpong.net
  13. worldchxampionshipofpingpong.net
  14. worlcdchampionshipofpingpong.net
  15. worldcthampionshipofpingpong.net
  16. worldchampoionshipofpingpong.net
  17. worldchbampionshipofpingpong.net
  18. worldchtampionshipofpingpong.net
  19. worldchnampionshipofpingpong.net
  20. worldcbhampionshipofpingpong.net
  21. worldchaxmpionshipofpingpong.net
  22. worldchazmpionshipofpingpong.net
  23. worldcvhampionshipofpingpong.net
  24. worldchamopionshipofpingpong.net
  25. worldcyhampionshipofpingpong.net
  26. worldcghampionshipofpingpong.net
  27. worldchanmpionshipofpingpong.net
  28. worldchamjpionshipofpingpong.net
  29. worldchsampionshipofpingpong.net
  30. worldcfhampionshipofpingpong.net
  31. worldchzampionshipofpingpong.net
  32. wofrldchampionshipofpingpong.net
  33. worldchampionsthipofpingpong.net
  34. worldchamlpionshipofpingpong.net
  35. worldchampionbshipofpingpong.net
  36. worldchampionashipofpingpong.net
  37. worldchamplionshipofpingpong.net
  38. worldchampionsehipofpingpong.net
  39. worldchampijonshipofpingpong.net
  40. worldchampionjshipofpingpong.net
  41. worldchampioinshipofpingpong.net
  42. worldchampionmshipofpingpong.net
  43. worldchampiojnshipofpingpong.net
  44. worldchampionsahipofpingpong.net
  45. worldchampionsdhipofpingpong.net
  46. worldchampjionshipofpingpong.net
  47. worldchampiponshipofpingpong.net
  48. worldchamnpionshipofpingpong.net
  49. worldchampiobnshipofpingpong.net
  50. worldchampionzshipofpingpong.net
  51. worldchampionsxhipofpingpong.net
  52. worldchampioneshipofpingpong.net
  53. worldchampkionshipofpingpong.net
  54. worldchuampionshipofpingpong.net
  55. worldchakmpionshipofpingpong.net
  56. worldchyampionshipofpingpong.net
  57. worldcjhampionshipofpingpong.net
  58. worldchawmpionshipofpingpong.net
  59. worldchamkpionshipofpingpong.net
  60. worldchjampionshipofpingpong.net
  61. worldcuhampionshipofpingpong.net
  62. worldcdhampionshipofpingpong.net
  63. worldschampionshipofpingpong.net
  64. worldchampiomnshipofpingpong.net
  65. dworldchampionshipofpingpong.net
  66. worfldchampionshipofpingpong.net
  67. worldechampionshipofpingpong.net
  68. worlsdchampionshipofpingpong.net
  69. worlpdchampionshipofpingpong.net
  70. wporldchampionshipofpingpong.net
  71. worldcbampionsbipofpingpong.net
  72. wsorldchampionshipofpingpong.net
  73. worldcgampionsgipofpingpong.net
  74. worldchamlionshiloflinglong.net
  75. worldchampionshipofpintpont.net
  76. aworldchampionshipofpingpong.net
  77. worldchamplonshlpofplngpong.net
  78. worldcjampionsjipofpingpong.net
  79. worldchampionshipofpinvponv.net
  80. worldfchampionshipofpingpong.net
  81. qworldchampionshipofpingpong.net
  82. wlrldchampilnshiplfpingplng.net
  83. worldchampionshipofpingponn.net
  84. worldchampionshipofpingponv.net
  85. worldchampionshipofpinrponr.net
  86. wdorldchampionshipofpingpong.net
  87. worldchampiojshipofpijgpojg.net
  88. worldchampiomshipofpimgpomg.net
  89. worldchampiobshipofpibgpobg.net
  90. worldchampionshipofpingponb.net
  91. worldchampionshipofpingponf.net
  92. worldchamoionshioofoingoong.net
  93. worldchampionshipofpinfponf.net
  94. wokrldchampionshipofpingpong.net
  95. wlorldchampionshipofpingpong.net
  96. wogrldchampionshipofpingpong.net
  97. worlidchampionshipofpingpong.net
  98. woreldchampionshipofpingpong.net
  99. worpldchampionshipofpingpong.net
  100. worlfdchampionshipofpingpong.net
  101. wotrldchampionshipofpingpong.net
  102. worgldchampionshipofpingpong.net
  103. worlrdchampionshipofpingpong.net
  104. worldwchampionshipofpingpong.net
  105. worlxdchampionshipofpingpong.net
  106. woprldchampionshipofpingpong.net
  107. woirldchampionshipofpingpong.net
  108. weorldchampionshipofpingpong.net
  109. worlodchampionshipofpingpong.net
  110. worldrchampionshipofpingpong.net
  111. woroldchampionshipofpingpong.net
  112. worledchampionshipofpingpong.net
  113. wordldchampionshipofpingpong.net
  114. wiorldchampionshipofpingpong.net
  115. wqorldchampionshipofpingpong.net
  116. woerldchampionshipofpingpong.net
  117. worlkdchampionshipofpingpong.net
  118. eworldchampionshipofpingpong.net
  119. workldchampionshipofpingpong.net
  120. wolrldchampionshipofpingpong.net
  121. wodrldchampionshipofpingpong.net
  122. wkorldchampionshipofpingpong.net
  123. worildchampionshipofpingpong.net
  124. wortldchampionshipofpingpong.net
  125. worlwdchampionshipofpingpong.net
  126. worldchampiuonshipofpingpong.net
  127. worldchampionsqhipofpingpong.net
  128. worldchampionshipofpindpond.net
  129. worldchampionshipofpingrpong.net
  130. worldchampionshipofpingtpong.net
  131. worldchampionshipofpingopong.net
  132. worldchampionshipofpihngpong.net
  133. worldchampionshipofpikngpong.net
  134. worldchampionshipofpinvgpong.net
  135. worldchampionshipofpinfgpong.net
  136. worldchampionshipofpingplong.net
  137. worldchampionshipofplingpong.net
  138. worldchampionshipofpoingpong.net
  139. worldchampionshipofbpingpong.net
  140. worldchampionshipofpintgpong.net
  141. worldchampionshipofpingvpong.net
  142. worldchampionshipofpinrgpong.net
  143. worldchampionshipofpimngpong.net
  144. worldchampionshipofpkingpong.net
  145. worldchampionshipofopingpong.net
  146. worldchampionshipofvpingpong.net
  147. worldchampionshipofpibngpong.net
  148. worldchampionshipofpindgpong.net
  149. worldchampionshipobfpingpong.net
  150. worldchampionshipofpingypong.net
  151. worldchampionshipofpiungpong.net
  152. worldchampionshipofpinjgpong.net
  153. worldchampionshipofpiongpong.net
  154. worldchampionshipofpinmgpong.net
  155. worldchampionshipofpinhgpong.net
  156. worldchampionshipofpingdpong.net
  157. worldchampionshipofpingfpong.net
  158. worldchampionshipofpinbgpong.net
  159. worldchampionshipofpingnpong.net
  160. worldchampionshipofpinglpong.net
  161. worldchampionshipofpingpiong.net
  162. worldchampionshipofpingpomng.net
  163. worldchampionshipofpingpobng.net
  164. worldchampionshipofpingponyg.net
  165. worldchampionshipofpingpohng.net
  166. worldchampionshipofpingpokng.net
  167. worldchampionshipofpingpkong.net
  168. worldchampionshipofpingponhg.net
  169. worldchampionshipofpingpoing.net
  170. worldchampionshipofpingponjg.net
  171. worldchampionshipofpingponmg.net
  172. worldchampionshipofpingpolng.net
  173. worldchampionshipofpingpopng.net
  174. worldchampionshipofpingpongv.net
  175. worldchampionshipofpingponfg.net
  176. worldchampionshipofpjingpong.net
  177. worldchampionshipofpingpongt.net
  178. worldchampionshipofpingpongh.net
  179. worldchampionshipofpingpojng.net
  180. worldchampionshipofpingpondg.net
  181. worldchampionshipofpingpongn.net
  182. worldchampionshipofpingpongy.net
  183. worldchampionshipofpingponrg.net
  184. worldchampionshipofpingpongf.net
  185. worldchampionshipofpingponvg.net
  186. worldchampionshipofpingpongb.net
  187. worldchampionshipofpingpontg.net
  188. worldchampionshipofpingpongr.net
  189. worldchampionshipofpingponbg.net
  190. worldchampionshipofpuingpong.net
  191. worldchampionshipofpilngpong.net
  192. worldchampionqshipofpingpong.net
  193. worldchampioncshipofpingpong.net
  194. worldchampionshipiofpingpong.net
  195. worldchampionshikpofpingpong.net
  196. worldchampionshiporfpingpong.net
  197. worldchampionshipotfpingpong.net
  198. worldchampionshjipofpingpong.net
  199. worldchampionshipofcpingpong.net
  200. worldchampionsnhipofpingpong.net
  201. worldchampionshiopofpingpong.net
  202. worldchampionshipoftpingpong.net
  203. worldchampionshipogfpingpong.net
  204. worldchampionshipokfpingpong.net
  205. worldchampionshgipofpingpong.net
  206. worldchampioknshipofpingpong.net
  207. worldchampiopnshipofpingpong.net
  208. worldchampionshijpofpingpong.net
  209. worldchampiohnshipofpingpong.net
  210. worldchampionswhipofpingpong.net
  211. worldchampionschipofpingpong.net
  212. worldchampionhshipofpingpong.net
  213. worldchampiolnshipofpingpong.net
  214. worldchampionszhipofpingpong.net
  215. worldchampiondshipofpingpong.net
  216. worldchampionshtipofpingpong.net
  217. worldchampikonshipofpingpong.net
  218. worldchampilonshipofpingpong.net
  219. worldchampuionshipofpingpong.net
  220. worldchampionwshipofpingpong.net
  221. worldchampionxshipofpingpong.net
  222. worldchampionshbipofpingpong.net
  223. worldchampionsbhipofpingpong.net
  224. worldchampionshipofpijngpong.net
  225. worldchampionshipofrpingpong.net
  226. worldchampionshipofpinghpong.net
  227. worldchampionshipofpingbpong.net
  228. worldchampionshipofpinygpong.net
  229. worldchampionshipoflpingpong.net
  230. worldchampionshoipofpingpong.net
  231. worldchampionshipofgpingpong.net
  232. worldchampionshnipofpingpong.net
  233. worldchampionshilpofpingpong.net
  234. worldchampionshipkofpingpong.net
  235. worldchampionshipocfpingpong.net
  236. worldchampionshkipofpingpong.net
  237. worldchampionshiupofpingpong.net
  238. worldchampionshipodfpingpong.net
  239. worldchampionshipovfpingpong.net
  240. worldchampionshipoefpingpong.net
  241. worldchampionsjhipofpingpong.net
  242. worldchampionsghipofpingpong.net
  243. worldchampionsuhipofpingpong.net
  244. worldchampionshipolfpingpong.net
  245. worldchampionshipofdpingpong.net
  246. worldchampionshipoifpingpong.net
  247. worldchampionshipopfpingpong.net
  248. worldchampionshiplofpingpong.net
  249. worldchampionshuipofpingpong.net
  250. worldchampionsyhipofpingpong.net
  251. worldchampionshlipofpingpong.net
  252. worldchampionshipofepingpong.net
  253. worldchampionshyipofpingpong.net
  254. worldchampionshipofpingponh.net
  255. worldctampionstipofpingpong.net
  256. wirldchampiinshipifpingping.net
  257. worldchampionshipofpingpog.net
  258. wolrdchampionshipofpingpong.net
  259. worldchampionsihpofpingpong.net
  260. worldchampinoshipofpingpong.net
  261. worldchampionshipofpinpgong.net
  262. worldchampionshipofpingpnog.net
  263. owrldchampionshipofpingpong.net
  264. wirldchampionshipofpingpong.net
  265. wordlchampionshipofpingpong.net
  266. worldchmapionshipofpingpong.net
  267. worldchampionshipofpingpogn.net
  268. aorldchampionshipofpingpong.net
  269. worldchampionshipofipngpong.net
  270. worldchampionshipofpiingpong.net
  271. wroldchampionshipofpingpong.net
  272. worldchampionshiofpingpong.net
  273. worldchampionshipoffpingpong.net
  274. worldchampionshipofpingppong.net
  275. worldhampionshipofpingpong.net
  276. worldchampionshipfpingpong.net
  277. worldchampionshipofpingpoong.net
  278. worldchampionshipofppingpong.net
  279. worldchampionhipofpingpong.net
  280. worldchamponshipofpingpong.net
  281. worldchampionshipofingpong.net
  282. worldchampionsshipofpingpong.net
  283. worldchampioonshipofpingpong.net
  284. worldchamppionshipofpingpong.net
  285. worldchampiosnhipofpingpong.net
  286. worldchampionshipofpnigpong.net
  287. worldchampionsipofpingpong.net
  288. dorldchampionshipofpingpong.net
  289. worlschampionshipofpingpong.net
  290. worldchsmpionshipofpingpong.net
  291. worldchanpionshipofpingpong.net
  292. worldcgampionshipofpingpong.net
  293. wotldchampionshipofpingpong.net
  294. worldcahmpionshipofpingpong.net
  295. qorldchampionshipofpingpong.net
  296. worlcdhampionshipofpingpong.net
  297. worldchamiponshipofpingpong.net
  298. worldchampionshipopfingpong.net
  299. eorldchampionshipofpingpong.net
  300. worldchampoinshipofpingpong.net
  301. worldhcampionshipofpingpong.net
  302. worldchampionshipofpingopng.net
  303. worldchampionshipofpigpong.net
  304. wprldchampionshipofpingpong.net
  305. worldchampionshipofpingpon.net
  306. worldchampionshipofpingpng.net
  307. worldchampionshipofpinpong.net
  308. worldchampionshipfopingpong.net
  309. sorldchampionshipofpingpong.net
  310. worldchampionshpiofpingpong.net
  311. worldchampionshiopfpingpong.net
  312. worldchampionhsipofpingpong.net
  313. worldchampionshipofpingong.net
  314. worldchampionshipofpngpong.net
  315. worldchapmionshipofpingpong.net
  316. worldchampionshipofpignpong.net
  317. worlchampionshipofpingpong.net
  318. woldchampionshipofpingpong.net
  319. worldchamoionshipofpingpong.net
  320. worldchampionshipofpingpong.net
  321. worldchhampionshipofpingpong.net
  322. wourldchampiounshipoufpingpoung.net
  323. worldtchampionshipofpingpong.net
  324. worldkhampionshipofpingpong.net
  325. wyrldchampiynshipyfpingpyng.net
  326. woorldchampionshipofpingpong.net
  327. worldchampaonshapofpangpong.net
  328. werldchampienshipefpingpeng.net
  329. worldchampuonshupofpungpong.net
  330. worldchaimpionshipofpingpong.net
  331. worldchampionshipophpingpong.net
  332. wor1dchampionshipofpingpong.net
  333. worldchempionshipofpingpong.net
  334. warldchampianshipafpingpang.net
  335. wworldchampionshipofpingpong.net
  336. worldchampionzhipofpingpong.net
  337. worldchampyonshypofpyngpong.net
  338. worldchampeionsheipofpeingpong.net
  339. worldchampoonshopofpongpong.net
  340. worldchampeonshepofpengpong.net
  341. worldchympionshipofpingpong.net
  342. worldchimpionshipofpingpong.net
  343. vorldchampionshipofpingpong.net
  344. worldcchampionshipofpingpong.net
  345. worldchampaionshaipofpaingpong.net
  346. w0rldchampi0nship0fpingp0ng.net
  347. worldchompionshipofpingpong.net
  348. worrldchampionshipofpingpong.net
  349. worldchumpionshipofpingpong.net
  350. worldsihampionshipofpingpong.net
  351. wordchampionshipofpingpong.net
  352. worldchampinshipofpingpong.net
  353. orldchampionshipofpingpong.net
  354. worldchampiionshipofpingpong.net
  355. worldchaampionshipofpingpong.net
  356. worldchampionshipofpinggpong.net
  357. worldchapionshipofpingpong.net
  358. worldchammpionshipofpingpong.net
  359. worldchmpionshipofpingpong.net
  360. worldchampionshiipofpingpong.net
  361. worldchampionshipofpingpongg.net
  362. worldchampionshippofpingpong.net
  363. wrldchampionshipofpingpong.net
  364. worldchampionshipofpingponng.net
  365. worldchamionshipofpingpong.net
  366. worldchampionshhipofpingpong.net
  367. worldchampion5hipofpingpong.net
  368. worldchampionshipopingpong.net
  369. worldchampionshipoofpingpong.net
  370. worldchampionshipofpinngpong.net
  371. worldchampioshipofpingpong.net
  372. worldchampionshpofpingpong.net
  373. worldcampionshipofpingpong.net
  374. worldchampionnshipofpingpong.net
  375. worldsyhampionshipofpingpong.net
  376. worlldchampionshipofpingpong.net
  377. worldcheimpionshipofpingpong.net
  378. worldch4mpionshipofpingpong.net
  379. wurldchampiunshipufpingpung.net
  380. worlddchampionshipofpingpong.net
  381. workdchampionshipofpingpong.net
  382. woridchampionshipofpingpong.net
  383. worldchampjonshjpofpjngpong.net
  384. worldchampionshipoflingpong.net
  385. worldchampionshipocpingpong.net
  386. worldchampionshipotpingpong.net
  387. worldchampionshipofpijgpong.net
  388. worldchampionshipofpingping.net
  389. worldchampionshipodpingpong.net
  390. worldchampionshipofpinglong.net
  391. worldchampionshipofpungpong.net
  392. worldchampionshipofpinypong.net
  393. worldchampionshipofpongpong.net
  394. worldchampionshipofpinfpong.net
  395. worldchampionshipofpintpong.net
  396. worldchampionshipofpingppng.net
  397. worldchampionshipofpingpkng.net
  398. worldchampionshipofpingpony.net
  399. worldchampionshipofpinvpong.net
  400. worldchampionshipofplngpong.net
  401. worldchampionshipofpihgpong.net
  402. worldchampionshipofpingpobg.net
  403. worldchampionshipofpingpomg.net
  404. worldchampionshipofpingoong.net
  405. worldchampionshipobpingpong.net
  406. worldchampionqhipofpingpong.net
  407. worldchampionshiplfpingpong.net
  408. worldchampiojshipofpingpong.net
  409. worldchampionahipofpingpong.net
  410. worldchampionsbipofpingpong.net
  411. worldchampionshipkfpingpong.net
  412. worldchampiondhipofpingpong.net
  413. worldchampionshipofpindpong.net
  414. worldchampionshipofpinhpong.net
  415. worldchampionshilofpingpong.net
  416. worldchampionshipofpibgpong.net
  417. worldcyampionsyipofpingpong.net
  418. worldchampiohshipofpihgpohg.net
  419. worldchampkonshkpofpkngpong.net
  420. worldchampionshipofpinhponh.net
  421. worldchampionshipofpinbponb.net
  422. wkrldchampiknshipkfpingpkng.net
  423. waorldchampionshipofpingpong.net
  424. worldcuampionsuipofpingpong.net
  425. worldcnampionsnipofpingpong.net
  426. worldchampionshipofpinnponn.net
  427. sworldchampionshipofpingpong.net
  428. worldchampionshipofpinypony.net
  429. wprldchampipnshippfpingppng.net
  430. worldchampionshipofpingponr.net
  431. worldchampionshipofpingpojg.net
  432. worldchampionshipofpkngpong.net
  433. worldchampionshipofpimgpong.net
  434. worldchampionshipofpinnpong.net
  435. worldchampionshipofpingpont.net
  436. worldchampionshipofpinrpong.net
  437. worldchampionshipofpjngpong.net
  438. worldchampionshipofpingpohg.net
  439. worldchampionshipofpingplng.net
  440. worldchampionshipofpingpond.net
  441. worldchampionshipofoingpong.net
  442. worldchampionshipovpingpong.net
  443. worldchampionshipogpingpong.net
  444. worldchampionshipofpinbpong.net
  445. worldchampiomshipofpingpong.net
  446. worldchampionshkpofpingpong.net
  447. worldchwmpionshipofpingpong.net
  448. worldvhampionshipofpingpong.net
  449. worlxchampionshipofpingpong.net
  450. worldcuampionshipofpingpong.net
  451. worldchakpionshipofpingpong.net
  452. worlcchampionshipofpingpong.net
  453. worlechampionshipofpingpong.net
  454. worldchxmpionshipofpingpong.net
  455. worldchqmpionshipofpingpong.net
  456. worldchamlionshipofpingpong.net
  457. wodldchampionshipofpingpong.net
  458. woeldchampionshipofpingpong.net
  459. wogldchampionshipofpingpong.net
  460. worldcyampionshipofpingpong.net
  461. worldchzmpionshipofpingpong.net
  462. worldctampionshipofpingpong.net
  463. worldchajpionshipofpingpong.net
  464. worlddhampionshipofpingpong.net
  465. wofldchampionshipofpingpong.net
  466. wlrldchampionshipofpingpong.net
  467. worlfchampionshipofpingpong.net
  468. worldcbampionshipofpingpong.net
  469. wkrldchampionshipofpingpong.net
  470. worldcjampionshipofpingpong.net
  471. worodchampionshipofpingpong.net
  472. worldxhampionshipofpingpong.net
  473. worpdchampionshipofpingpong.net
  474. worldfhampionshipofpingpong.net
  475. worlvchampionshipofpingpong.net
  476. worldcnampionshipofpingpong.net
  477. worlwchampionshipofpingpong.net
  478. worlrchampionshipofpingpong.net
  479. worldchampionshiporpingpong.net
  480. worldchampionshupofpingpong.net
  481. worldchampipnshipofpingpong.net
  482. worldchampjonshipofpingpong.net
  483. worldchamplonshipofpingpong.net
  484. worldchampionsjipofpingpong.net
  485. worldchampionshipifpingpong.net
  486. worldchampionsuipofpingpong.net
  487. worldchampionsgipofpingpong.net
  488. worldchampionstipofpingpong.net
  489. worldchampkonshipofpingpong.net
  490. worldchampuonshipofpingpong.net
  491. worldchampionehipofpingpong.net
  492. worldchampionshopofpingpong.net
  493. worldchampoonshipofpingpong.net
  494. worldchampiknshipofpingpong.net
  495. worldchampiinshipofpingpong.net
  496. worldchampionchipofpingpong.net
  497. worldchampiobshipofpingpong.net
  498. worldchampionsyipofpingpong.net
  499. worldchampionxhipofpingpong.net
  500. worldchampionshlpofpingpong.net
  501. worldchampionshjpofpingpong.net
  502. worldchampilnshipofpingpong.net
  503. worldchampionshipoepingpong.net
  504. worldchampiohshipofpingpong.net
  505. worldchampionwhipofpingpong.net
  506. worldchampionshioofpingpong.net
  507. worldchampionshippfpingpong.net
  508. worldchampionsnipofpingpong.net
  509. worldchampionshipofpingpongd.net
Safeness details
Child Safety Rating according to WOT:Unspecified
Google Safety Rating:Unspecified
WOT Trustworthiness Ranking:Unspecified
Index page information
Off-site URLs
Physical server location:United Kingdom
Host IP address:
Alexa ranking information
Past 30 days trend
Rank:852 168
Recent update2017/Feb/28
Relevant links
Waiting for information
Spread rank:Unspecified
Rank fluctuation:+103 746
Last year overview
Website region:Unspecified
Countrywide positionUnspecified
What people think
HTTP header response data:
X-Powered-By: PleskLin Connection: keep-alive Content-Length: 24882 X-Cache: MISS Age: 0 Content-Type: text/html; charset=UTF-8 Via: WebCelerate Date: Thu, 15 Jun 2017 06:47:46 GMT X-Powered-By: PHP/5.4.45 HTTP/1.1 200 OK X-Cacheable: YES Accept-Ranges: bytes Server: Apache Link: <http://www.worldchampionshipofpingpong.net/wp-json/>; rel="https://api.w.org/", <http://www.worldchampionshipofpingpong.net/>; rel=shortlink
Relevant Accounts and Profiles
AddThis ID:Waiting for information
Analytics ID:44652587-1
Adsense profile:Waiting for information
Google Plus Account:Waiting for information
Nameservers information
Scottsdale; AZ; United States; 85260216.69.185.25ns49.domaincontrol.com
Scottsdale; AZ; United States; 85260208.109.255.25ns50.domaincontrol.com

Ranked Sites
0.0091 // 2018-06-21 03:42:48 1